Establishment of an RNAi application platform in Mycobacterium tuberculosis infection models [Elektronische Ressource] / Ulrike Jung. Betreuer: Stefan Kaufmann

genehmigteAuDr.tTofDr.anSHERNAiD83applicationUnivplatformu:inBericMychobderacterium15.04.2010tubhaftenerhniscculosisatinfectionPromotionsausscmoorsitzender:delsKurrecvter:orgelegtLaustervProf.onTDiplom-HumanhaftlicbiologinspracUlrik201eEstablishmenJungderausecDresdenhenzurersitErlangungBerlindesDissertationakhademiscVhenProf.GradesJ.DoktorinkderhNaturwissenscProf.haftenR.Dr.Bericrer.ter:nat.Dr.vKaufmannonagderwissenscFhenakultsathe:IBerlinI0I1{ProzesswissenscheralwaysdeMlyawhateversterginextthewhich.artelolefislivingomakes{littlehardistinctionwhichbsimplyetweofeneherdoworkothersandwhetherherorplay,playing.hershelabborBuddhistandSheherdleisurknowse,isherShemindpursuesandvisionherexcblencoindy,sheheres,eavingductoationcideandsheherwrkineorcrTeheration,isherdoingloveoth.andZenherTrTheeligion..Kits.able.of.Conoticten.ts.1.In.tro.ductionstrains7.1.1.Gene.e.xpression.in.euk3.1ary.otes..............king.......gene.........thesis.....3.1.1............7.1.1.1.DNA.and.the.comp.osition33of.a3.1.8protein-co.dingtibioticsgene......to...P.k.....of7.1.1.2CellularT.ranscription....2.and...................3.1.2.....
Publié le : dimanche 1 janvier 2012
Lecture(s) : 12
Source : D-NB.INFO/1019398604/34
Nombre de pages : 138
Voir plus Voir moins

DissertationEstablishmenstR.ofecanJ.RNAiKaufmannapplication1platformersitinVMychobter:acteriumwissensctubBerlinerderculosisheninfectionBerlinmohdelsProf.vkorgelegtProf.vBericonDr.Diplom-HumanagbiologinhenUlrikhe:e0JunghaftenausTDresdenhnisczurUnivErlangungatdesgenehmigteakPromotionsausscademiscu:henorsitzender:GradesDr.DoktorinKurrecderBericNaturwissenscter:haftenDr.Dr.Lausterrer.hnat.Prof.vSHEonTderderFhaftlicakultAuatspracI15.04.2010I201ID83{ProzesswissenscvisionThedoingMcideaknowsstersheinortheSheartSheolencfavinglivingwmakesherlittleZendistinctiondbisetwepursuesenexcherinworkes,andtohersheplay,kinherTlabisoroth.andTherharleisurlye,whichherwhich.mindsimplyandherherofbeloedy,whateverherdoeleducothersationdeandwhetherherisroregcrplaying.eoation,sheheralwaysloveband{herBuddhistrexteligion..T.able.of.Con.tencellts.1.In.tro.duction.7.1.1.Gene.e.xpression.in.euk.aryMaterialotes................solution.......kno.........29.....Enzymes..........7.1.1.1.DNA.and.the.comp.osition.of3.1.7a.protein-coAnding.geneand.......ols...oten.out....7siRNAs1.1.2.Textractranscription......Aim.Metho...................Other.......3.1.3.......31................83.1.61.1.3.Maturation.of.mR.NA........and.....39.......Buer.......w.........d.and.otes........8431.1.4.T.ranslation..................27.this.Material.30...................30.................308.1.2.Regulation.o.f.gene.expre.s.sionaryb.y.endogenously.triggered.RNA.in.terference.9Bacteria1.2.1.Ma.jor.c.omp.onen.ts.of3.1.5the.RNA.in.terference.path.w.a.ys.................10.1.2.2.Gene.expression.regulation.b.y.microRNAs....34.o.c...........An.ungicides......12.1.3.Regulation39osolutionsf.gene.expre.s.sion.b.y3.1.11articially&tr.ig.gered.RNA.in.terference....3.216new1.3.1establishsiRNAskdo.c.prok.....................Design...............3.2.2........................16.1.3.2.shRNAs.&2articialofmiRNAsthesis.3.and.ds.3.1....................................17.1.43.1.1Deliv.ery.systems.for.articial.RNAi.platforms.and.side.eects...............193.1.21.4.1materialViral.deliv.ery.systems.for.RNAi.pla.t.fo.r.ms........30.Euk.otic.lines..............19.1.4.2.P.o.ss.ib.le3.1.4eectsstrainsof.vir.a.l.infections.on.g.ene.expression.regulation.in.euk.ary.o.t31icKitscells..................................33.siRNAs......................20.1.5.T.ub.erculosis..33.Primer/oligomers.............................3.1.8.tib.dies.blo.king.....................3.1.9.tibiotics.F..22.1.5.1.Causativ.e.agen.t............3.1.10.and...........................39.Soft.are.to..........22.1.5.2.Diagnosis.and.pathology..........43.P.tial.metho.to.gene.c.wn.kno.k.in.ary-................23.1.5.3.V.accination.and.therap.y............3.2.1.of.............................43.Cellular.generation25.1.5.4.Lo.cal.and.global.imp.ortance........44.633.2.3.ElectroReagencomp.eten.tforM..sme.gmatis64.y...c...3.4.13...estern...bacteria.h....................44.3.2.4GreenElectro.compknoeten.t.L..mono.cyto.genes....ds.pHIV8-GFP.and.....hlorid-comp.60...Virus...3.4.11...........Cell45.3.2.5.Electro.comp.eten.t.E..cpoliout.....died.Conrmation.dendritic.....3.4.2.or.53.........-1...54.....iRNA...57....45.3.2.6cElectro.comp.eten.t.BC.Gk.......harv.....arget.........................ycin.......erse..45.3.2.7.Electrop.oration.of.Prok4.1arymethootesand...........t.T-PCR...of.aqMan.............of.mono.cells...Luciferase46.3.2.8.Culturing.and.c.lone.testing.(PCR,54Fluoroscan)based.transfection.......Construction.pHIV9-Purom.....3.4.6.of..46.3.2.9.Purication.ofNorthernmRNAdetection.........3.4.8.t.(heat.comp...Plasmid.............60.ector..............46v3.2.10undsiRNA.re-puri

Soyez le premier à déposer un commentaire !

17/1000 caractères maximum.